splicing factor 1 (SF1) (NM_201998) Human Recombinant Protein
CAT#: TP305846
Recombinant protein of human splicing factor 1 (SF1), transcript variant 3, 20 µg
View other "splicing factor 1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205846 protein sequence
Red=Cloning site Green=Tags(s) MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAAAMARAMRVRTFRAHW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_973727 |
Locus ID | 7536 |
UniProt ID | Q15637 |
Refseq Size | 2949 |
Cytogenetics | 11q13.1 |
Refseq ORF | 1644 |
Synonyms | BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162 |
Summary | This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016] |
Protein Families | Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
FGF9 is a downstream target of SRY and sufficient to determine male sex fate in ex vivo XX gonad culture.
,null,
Biology of reproduction
,PubMed ID 32886743
[SF1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404503 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404504 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404505 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417858 | SF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY404503 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 2 |
CNY 4,840.00 |
|
LY404504 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 4 |
CNY 3,080.00 |
|
LY404505 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 3 |
CNY 3,080.00 |
|
LY417858 | Transient overexpression lysate of splicing factor 1 (SF1), transcript variant 1 |
CNY 4,840.00 |
|
PH305846 | SF1 MS Standard C13 and N15-labeled recombinant protein (NP_973727) |
CNY 19,520.00 |
其它splicing factor 1产品