neurobeachin like 1 (NBEAL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NBEAL1 antibody: synthetic peptide directed towards the N terminal of human NBEAL1. Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	153 kDa
Gene Name	neurobeachin like 1
Database Link	NP_945183 Entrez Gene 65065 Human UniProt ID Q6ZS30
Background	NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.
Synonyms	A530083I02Rik; ALS2CR16; ALS2CR17; FLJ22838; FLJ26555; MGC164581; MGC168834
Note	Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.