RBM45 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RBM45 antibody: synthetic peptide directed towards the middle region of human RBM45. Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	RNA binding motif protein 45
Database Link	NP_694453 Entrez Gene 129831 Human UniProt ID Q8IUH3
Background	RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains.
Synonyms	DRB1; RB-1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.