PNPT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	polyribonucleotide nucleotidyltransferase 1
Database Link	NP_149100 Entrez Gene 87178 Human UniProt ID Q8TCS8
Background	PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation (Raijmakers et al., 2002 [PubMed 12419256]). [supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	COXPD13; DFNB70; old-35; OLD35; PNPASE
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Pathways	Purine metabolism, Pyrimidine metabolism, RNA degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.