PNPT1 Rabbit Polyclonal Antibody

CAT#: TA343959

Rabbit Polyclonal Anti-PNPT1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of polyribonucleotide nucleotidyltransferase 1 (PNPT1)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00

Specifications

Product Data
Applications IHC
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 86 kDa
Gene Name polyribonucleotide nucleotidyltransferase 1
Background PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation (Raijmakers et al., 2002 [PubMed 12419256]). [supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms COXPD13; DFNB70; old-35; OLD35; PNPASE
Note Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Pathways Purine metabolism, Pyrimidine metabolism, RNA degradation
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...