SLIRP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C14ORF156 antibody: synthetic peptide directed towards the N terminal of human C14ORF156. Synthetic peptide located within the following region: PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	SRA stem-loop interacting RNA binding protein
Database Link	NP_112487 Entrez Gene 81892 Human UniProt ID Q9GZT3
Background	As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.
Synonyms	C14orf156; DC50; PD04872
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.