SRBD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SRBD1 antibody: synthetic peptide directed towards the N terminal of human SRBD1. Synthetic peptide located within the following region: MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	112 kDa
Gene Name	S1 RNA binding domain 1
Database Link	NP_060549 Entrez Gene 55133 Human UniProt ID Q8N5C6
Background	SRBD1 contains 1 S1 motif domain. The exact function of SRBD1 remains unknown.
Synonyms	FLJ10379
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Mouse: 86%; Zebrafish: 80%; Yeast: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.