HSD17B11 Rabbit Polyclonal Antibody

CAT#: TA343846

Rabbit Polyclonal Anti-HSD17B11 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11), 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC
Recommend Dilution IHC, WB
Reactivity Monkey
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 33 kDa
Gene Name hydroxysteroid (17-beta) dehydrogenase 11
Background Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).
Synonyms 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Bovine: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...