CSDC2 Rabbit Polyclonal Antibody

CAT#: TA343811

Rabbit Polyclonal Anti-CSDC2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CSDC2 antibody: synthetic peptide directed towards the N terminal of human CSDC2. Synthetic peptide located within the following region: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 17 kDa
Gene Name cold shock domain containing C2
Background CSDC2 is an RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Synonyms dJ347H13.2; PIPPIN
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 79%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...