RBFOX2 Rabbit Polyclonal Antibody
CN¥ 5,250.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | RNA binding protein, fox-1 homolog 2 |
Database Link | |
Background | RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. |
Synonyms | dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Horse: 85%; Yeast: 85%; Goat: 76%; Bovine: 75% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |