ZNF423 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF423 antibody: synthetic peptide directed towards the middle region of human ZNF423. Synthetic peptide located within the following region: CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	144 kDa
Gene Name	zinc finger protein 423
Database Link	NP_055884 Entrez Gene 23090 Human UniProt ID Q2M1K9
Background	ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
Synonyms	Ebfaz; JBTS19; NPHP14; OAZ; Roaz; Zfp104; ZFP423
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.