ZNF185 Rabbit Polyclonal Antibody
CAT#: TA343662
Rabbit Polyclonal Anti-ZNF185 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF185 antibody: synthetic peptide directed towards the N terminal of human ZNF185. Synthetic peptide located within the following region: LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | zinc finger protein 185 (LIM domain) |
Database Link | |
Background | ZNF185 contains 1 LIM zinc-binding domain. The function of ZNF185 remains unknown.ZNF185 encodes a LIM-domain zinc finger protein. These proteins are thought to be involved in protein-protein interactions. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1276 AY997296.1 1-1276 1277-4307 AK056517.1 347-3377 4308-4312 BQ923456.1 628-632 |
Synonyms | SCELL |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |