IKB epsilon (NFKBIE) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NFKBIE antibody: synthetic peptide directed towards the middle region of human NFKBIE. Synthetic peptide located within the following region: DARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	NFKB inhibitor epsilon
Database Link	NP_004547 Entrez Gene 18037 MouseEntrez Gene 4794 Human UniProt ID O00221
Background	NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-ka
Synonyms	IKBE
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Adipocytokine signaling pathway, B cell receptor signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.