ZNF259 (ZPR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF259 antibody: synthetic peptide directed towards the N terminal of human ZNF259. Synthetic peptide located within the following region: PPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	ZPR1 zinc finger
Database Link	NP_003895 Entrez Gene 8882 Human UniProt ID O75312
Background	ZNF259 may be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus. ZNF259 binds to the EGFR and is released from the receptor after activation.ZNF259 is essential for cell viability and its interaction with eEF-1alpha contributes to normal cellular proliferation.ZNF259 translocates from the cytoplasm to the nucleus after treatment of cells with mitogens. ZNF259 accumulates in the nucleolus of proliferating cells. Loss of ZNF259 caused disruption of nucleolar function, including preribosomal RNA expression. ZNF259 is an essential protein that is required for normal nucleolar function in proliferating cells.
Synonyms	ZNF259
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.