ABI3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Abi3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Abi3. Synthetic peptide located within the following region: DEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTRRYSDGWCEGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	ABI family member 3
Database Link	NP_057512 Entrez Gene 66610 Mouse UniProt ID Q9P2A4
Background	Abi3 inhibits ectopic tumor cell metastasis of SRD cells. In vitro, It reduces cell motility.
Synonyms	NESH; SSH3BP3
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.