Angiopoietin 2 (ANGPT2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	angiopoietin 2
Database Link	NP_001138 Entrez Gene 11601 Mouse UniProt ID O15123
Background	Angpt2 binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. It can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Synonyms	AGPT2; ANG2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.