Angiopoietin 2 (ANGPT2) Rabbit Polyclonal Antibody
CAT#: TA343276
Rabbit Polyclonal Anti-ANGPT2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | angiopoietin 2 |
Database Link | |
Background | Angpt2 binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. It can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal. |
Synonyms | AGPT2; ANG2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Prostaglandin-mediated effects in early canine corpus luteum: In vivo effects on vascular and immune factors
,Tavares Pereira, M;Gram, A;Nowaczyk, R;Boos, A;Hoffmann, B;Janowski, T;Kowalewski, MP;,
Reprod Biol
,PubMed ID 30929911
[ANGPT2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Angiopoietin 2产品