GPATCH4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPATCH4 antibody is: synthetic peptide directed towards the N-terminal region of Human GPATCH4. Synthetic peptide located within the following region: KPNLLYQKFVKMATLTSGGEKPNKDLESCSDDDNQGSKSPKILTDEMLLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	G-patch domain containing 4
Database Link	NP_056405 Entrez Gene 54865 Human
Background	The function of this protein remains unknown.
Synonyms	GPATC4
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Pig: 85%; Rat: 79%; Horse: 79%; Bovine: 79%; Guinea pig
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.