ALS2CR1 (NIF3L1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NIF3L1 antibody is: synthetic peptide directed towards the C-terminal region of Human NIF3L1. Synthetic peptide located within the following region: LDKVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	NGG1 interacting factor 3 like 1
Database Link	NP_001129511 Entrez Gene 60491 Human UniProt ID Q9GZT8
Background	The function of this protein remains unknown.
Synonyms	ALS2CR1; CALS-7; MDS015
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Bovine: 86%; Rabbit: 86%; Goat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.