SLAMF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	signaling lymphocytic activation molecule family member 1
Database Link	NP_003028 Entrez Gene 27218 Mouse UniProt ID Q13291
Background	Slamf1 is a high-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
Synonyms	CD150; CDw150; SLAM
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Mouse: 87%; Dog: 85%; Horse: 85%; Rabbit: 80%; Guinea pig: 80%; Goat; Sheep; Bovine
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.