Calneuron 1 (CALN1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CALN1 antibody is: synthetic peptide directed towards the N-terminal region of Human CALN1. Synthetic peptide located within the following region: PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	calneuron 1
Database Link	NP_113656 Entrez Gene 83698 Human UniProt ID Q9BXU9
Background	This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants.
Synonyms	CABP8
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Bovine: 91%; Rat: 83%; Mouse: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.