PTPN7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ptpn7 antibody is: synthetic peptide directed towards the middle region of Rat Ptpn7. Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	protein tyrosine phosphatase, non-receptor type 7
Database Link	NP_002823 Entrez Gene 246781 Rat UniProt ID P35236
Background	Tyrosine phosphatase found in T cells, B cells and mast cells.
Synonyms	BPTP-4; HEPTP; LC-PTP; LPTP; PTPNI
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Horse: 92%; Zebrafish
Reference Data
Protein Families	Druggable Genome, Phosphatase
Protein Pathways	MAPK signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.