D aspartate oxidase (DDO) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DDO antibody: synthetic peptide directed towards the C terminal of human DDO. Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	D-aspartate oxidase
Database Link	NP_004023 Entrez Gene 8528 Human UniProt ID Q99489
Background	The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms	DASOX; DDO-1; DDO-2
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Pathways	Alanine, aspartate and glutamate metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.