IL18 Rabbit Polyclonal Antibody
CNY 5,250.00
Cited in 1 publication. |
CNY 3,080.00
CNY 2,900.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 18 kDa |
Gene Name | interleukin 18 |
Database Link | |
Background | The protein encoded by this gene is a proinflammatory cytokine. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. |
Synonyms | IGIF; IL-1g; IL-18; IL1F4 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
A pilot study evaluating GSK1070806 inhibition of interleukin-18 in renal transplant delayed graft function
,null,
PLoS ONE
,PubMed ID 33684160
[IL18]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |