MASTL Rabbit Polyclonal Antibody

CAT#: TA343024

Rabbit Polyclonal Anti-MASTL Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human microtubule associated serine/threonine kinase-like (MASTL), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human microtubule associated serine/threonine kinase-like (MASTL), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 97 kDa
Gene Name microtubule associated serine/threonine kinase like
Background This gene encodes a microtubule-associated serine/threonine kinase. Mutations at this locus have been associated with autosomal dominant thrombocytopenia, also known as thrombocytopenia-2. Alternatively spliced transcript variants have been described for this locus.
Synonyms GREATWALL; GW; GWL; MAST-L; THC2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 82%; Pig: 79%; Horse: 79%; Bovine: 79%; Rat; Mouse; Guinea pig
Reference Data
Protein Families Druggable Genome, Protein Kinase
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...