HSDL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HSDL1 antibody: synthetic peptide directed towards the N terminal of human HSDL1. Synthetic peptide located within the following region: SRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	hydroxysteroid dehydrogenase like 1
Database Link	NP_113651 Entrez Gene 83693 Human UniProt ID Q3SXM5
Background	The function remains unknown.
Synonyms	SDR12C3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 79%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.