CNDP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	carnosine dipeptidase 1
Database Link	NP_116038 Entrez Gene 84735 Human UniProt ID Q96KN2
Background	CNDP1 is a member of the M20 metalloprotease family. The protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. CNDP1 gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.
Synonyms	CN1; CPGL2; HsT2308
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Guinea pig
Reference Data
Protein Families	Protease, Secreted Protein
Protein Pathways	beta-Alanine metabolism, Histidine metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.