CNDP1 Rabbit Polyclonal Antibody

CAT#: TA343002

Rabbit Polyclonal Anti-CNDP1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human carnosine dipeptidase 1 (metallopeptidase M20 family) (CNDP1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 57 kDa
Gene Name carnosine dipeptidase 1
Background CNDP1 is a member of the M20 metalloprotease family. The protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. CNDP1 gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.
Synonyms CN1; CPGL2; HsT2308
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Guinea pig
Reference Data
Protein Families Protease, Secreted Protein
Protein Pathways beta-Alanine metabolism, Histidine metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...