VARP (ANKRD27) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANKRD27 antibody: synthetic peptide directed towards the C terminal of human ANKRD27. Synthetic peptide located within the following region: DSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	117 kDa
Gene Name	ankyrin repeat domain 27
Database Link	NP_115515 Entrez Gene 84079 Human UniProt ID Q96NW4
Background	ANKRD27 may be a Rab21 guanine exchange factor and regulate endosome dynamics.
Synonyms	PP12899; VARP
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Mouse: 91%; Horse: 86%; Pig: 85%; Guinea pig: 85%; Bovine
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.