ACBD6 Rabbit Polyclonal Antibody
CAT#: TA342938
Rabbit Polyclonal Anti-ACBD6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACBD6 antibody: synthetic peptide directed towards the middle region of human ACBD6. Synthetic peptide located within the following region: EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | acyl-CoA binding domain containing 6 |
Database Link | |
Background | ACBD6 binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. Does not bind fatty acids. |
Synonyms | MGC2404 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Horse: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |