MFI2 (MELTF) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	IF, WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	melanotransferrin
Database Link	NP_005920 Entrez Gene 4241 Human UniProt ID P08582
Background	MFI2 is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified.
Synonyms	CD228; MAP97; MTf; MTF1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Dog: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.