LTBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LTBP1 antibody: synthetic peptide directed towards the C terminal of human LTBP1. Synthetic peptide located within the following region: NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	154 kDa
Gene Name	latent transforming growth factor beta binding protein 1
Database Link	NP_000618 Entrez Gene 4052 Human UniProt ID Q14766
Background	The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms.
Synonyms	MGC163161
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Bovine: 92%; Rabbit: 92%; Horse: 86%; Pig: 83%; Rat: 83%; Mouse: 83%; Guinea pig: 83%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.