CYP21A2 Rabbit Polyclonal Antibody
CAT#: TA342859
Rabbit Polyclonal Anti-CYP21A2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | IHC, WB |
Reactivity | Human, Monkey |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | cytochrome P450 family 21 subfamily A member 2 |
Database Link | |
Background | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene. |
Synonyms | CA21H; CAH1; CPS1; CYP21; CYP21B; P450c21B |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 80% |
Reference Data | |
Protein Families | Druggable Genome, P450 |
Protein Pathways | C21-Steroid hormone metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它CYP21A2产品