CYP21A2 Rabbit Polyclonal Antibody

CAT#: TA342859

Rabbit Polyclonal Anti-CYP21A2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of cytochrome P450, family 21, subfamily A, polypeptide 2 (CYP21A2), transcript variant 1
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human cytochrome P450, family 21, subfamily A, polypeptide 2 (CYP21A2), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human cytochrome P450, family 21, subfamily A, polypeptide 2 (CYP21A2), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution IHC, WB
Reactivity Human, Monkey
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name cytochrome P450 family 21 subfamily A member 2
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in this gene cause congenital adrenal hyperplasia. A related pseudogene is located near this gene; gene conversion events involving the functional gene and the pseudogene are thought to account for many cases of steroid 21-hydroxylase deficiency. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms CA21H; CAH1; CPS1; CYP21; CYP21B; P450c21B
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 80%
Reference Data
Protein Families Druggable Genome, P450
Protein Pathways C21-Steroid hormone metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...