Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	carbonic anhydrase 2
Database Link	NP_000058 Entrez Gene 760 Human UniProt ID P00918
Background	CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye.
Synonyms	CA-II; CAC; CAII; Car2; HEL-76; HEL-S-282
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 91%; Sheep: 85%; Bovine: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Nitrogen metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.