ZNHIT2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNHIT2 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNHIT2. Synthetic peptide located within the following region: KGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	zinc finger HIT-type containing 2
Database Link	NP_055020 Entrez Gene 741 Human UniProt ID Q9UHR6
Background	The function of this protein remains unknown.
Synonyms	C11orf5; FON
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Rat: 91%; Mouse: 90%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 82%; Guinea pig: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.