HHIPL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HHIPL1 antibody: synthetic peptide directed towards the C terminal of human HHIPL1. Synthetic peptide located within the following region: EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	85 kDa
Gene Name	HHIP like 1
Database Link	NP_115801 Entrez Gene 84439 Human UniProt ID Q96JK4
Background	The function of this protein remains unknown.
Synonyms	KIAA1822; UNQ9245
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 91%; Dog: 86%; Zebrafish: 86%; Guinea pig: 86%; Bovine: 85%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.