RAP1GDS1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAP1GDS1 antibody: synthetic peptide directed towards the middle region of human RAP1GDS1. Synthetic peptide located within the following region: LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	Rap1 GTPase-GDP dissociation stimulator 1
Database Link	NP_001093899 Entrez Gene 5910 Human UniProt ID P52306
Background	The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).
Synonyms	GDS1; SmgGDS
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.