SNAP29 Rabbit Polyclonal Antibody
CAT#: TA342640
Rabbit Polyclonal Anti-SNAP29 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | synaptosome associated protein 29kDa |
Database Link | |
Background | Snap29 binds with Snap25 to form complexin. |
Synonyms | CEDNIK; SNAP-29 |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Zebrafish: 82%; Human: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |