SNAP29 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	synaptosome associated protein 29kDa
Database Link	NP_004773 Entrez Gene 116500 Rat UniProt ID O95721
Background	Snap29 binds with Snap25 to form complexin.
Synonyms	CEDNIK; SNAP-29
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Zebrafish: 82%; Human: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	SNARE interactions in vesicular transport

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.