GOSR1 Rabbit Polyclonal Antibody
CAT#: TA342639
Rabbit Polyclonal Anti-GOSR1 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GOSR1 antibody: synthetic peptide directed towards the C terminal of human GOSR1. Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | golgi SNAP receptor complex member 1 |
Database Link | |
Background | This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Synonyms | GOLIM2; GOS-28; GOS28; GS28; P28 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |