UBL4A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UBL4A antibody: synthetic peptide directed towards the C terminal of human UBL4A. Synthetic peptide located within the following region: SAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	ubiquitin like 4A
Database Link	NP_055050 Entrez Gene 8266 Human UniProt ID P11441
Background	UBL4A is a component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. UBL4A is the TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
Synonyms	DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 92%; Horse: 92%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.