USP17L2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-USP17L2 antibody: synthetic peptide directed towards the middle region of human USP17L2. Synthetic peptide located within the following region: FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	ubiquitin specific peptidase 17-like family member 2
Database Link	NP_958804 Entrez Gene 377630 Human UniProt ID Q6R6M4
Background	DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.
Synonyms	DUB-3; DUB3; USP17
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.