VARS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	118 kDa
Gene Name	valyl-tRNA synthetase 2, mitochondrial
Database Link	NP_065175 Entrez Gene 57176 Human UniProt ID Q5ST30
Background	The function of the protein remains unknown.
Synonyms	COXPD20; VALRS; VARS2L; VARSL
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Aminoacyl-tRNA biosynthesis, Valine, leucine and isoleucine biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.