LAPTM4B Rabbit Polyclonal Antibody

CAT#: TA342374

Rabbit Polyclonal Anti-LAPTM4B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of lysosomal protein transmembrane 4 beta (LAPTM4B)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human lysosomal protein transmembrane 4 beta (LAPTM4B), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human lysosomal protein transmembrane 4 beta (LAPTM4B), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-LAPTM4B antibody: synthetic peptide directed towards the middle region of human LAPTM4B. Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name lysosomal protein transmembrane 4 beta
Background LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
Synonyms LAPTM4beta; LC27
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Lysosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...