HHAT Rabbit Polyclonal Antibody

CAT#: TA342360

Rabbit Polyclonal Anti-HHAT Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human hedgehog acyltransferase (HHAT), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human hedgehog acyltransferase (HHAT), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HHAT antibody: synthetic peptide directed towards the N terminal of human HHAT. Synthetic peptide located within the following region: MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 57 kDa
Gene Name hedgehog acyltransferase
Background 'Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725). [supplied by OMIM, Jul 2002]. Transcript Variant: This variant (4) lacks an in-frame exon in the coding region compared to variant 1. The encoded isoform (3) is shorter than isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK298991.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025090 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms MART2; SKI1; Skn
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 79%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...