Elf4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Elf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DDLKKTSDAGDQKEHSEEEKVSREENLRKMGKARKRNRKTKNNRSTSPVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	E74-like factor 4 (ets domain transcription factor)
Database Link	NP_062654 Entrez Gene 56501 Mouse UniProt ID Q9Z2U4
Background	The function of Elf4 remains unknown.
Synonyms	ELFR; MEF
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.