PTF1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ptf1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ptf1a. Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	pancreas specific transcription factor, 1a
Database Link	NP_835455 Entrez Gene 19213 Mouse UniProt ID Q7RTS3
Background	Ptf1a is a transcriptional activator. It binds to the E-box consensus sequence 5'-CANNTG-3' and may play a role in early and late pancreas development and differentiation. Ptf1a plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates and may be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. It is required for the formation of pancreatic acinar and ductal cells. and plays an important role in cerebellar development.
Synonyms	bHLHa29; PACA; PAGEN2; PTF1-p48
Note	Immunogen Sequence Homology: Mouse: 100%; Pig: 93%; Rat: 93%; Human: 93%; Bovine: 93%; Horse: 92%; Dog: 86%
Reference Data
Protein Families	Embryonic stem cells, ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.