MYBBP1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Mybbp1a antibody: synthetic peptide directed towards the middle region of mouse Mybbp1a. Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	152 kDa
Gene Name	MYB binding protein 1a
Database Link	NP_055335 Entrez Gene 18432 Mouse UniProt ID Q9BQG0
Background	Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.
Synonyms	P160; PAP2
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Human: 86%; Bovine: 79%
Reference Data
Protein Families	Stem cell - Pluripotency, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.