Dmrt1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dmrt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPSSYAVNQVLEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	doublesex and mab-3 related transcription factor 1
Database Link	NP_056641 Entrez Gene 50796 Mouse UniProt ID Q9QZ59
Background	The function of this protein remains unknown.
Synonyms	DMT1
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.