Tpbg Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tpbg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tpbg. Synthetic peptide located within the following region: GDGRLRLARLALVLLGWVSASAPSSSVPSSSTSPAAFLASGSAQPPPAER
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	trophoblast glycoprotein
Database Link	NP_035757 Entrez Gene 21983 Mouse UniProt ID Q9Z0L0
Background	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Synonyms	5T4; 5T4-AG; 5T4AG; M6P1
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.