Mxd1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Mxd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	MAX dimerization protein 1
Database Link	NP_034881 Entrez Gene 17119 Mouse
Background	The function of Mxd1 remains unknown.
Synonyms	MAD; MAD1; MGC104659
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Rabbit: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.