NIT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NIT1 antibody: synthetic peptide directed towards the N terminal of human NIT1. Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	nitrilase 1
Database Link	NP_005591 Entrez Gene 4817 Human UniProt ID Q86X76
Background	This gene encodes a member ofThe nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides toThe corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jun 2010]
Synonyms	MGC57670
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Bovine: 86%; Rat: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.