MRE11 Rabbit Polyclonal Antibody
CAT#: TA342247
Rabbit polyclonal Anti-MRE11A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 80 kDa |
Gene Name | MRE11 homolog A, double strand break repair nuclease |
Database Link | |
Background | This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself,The protein has 3' to 5' exonuclease activity and endonuclease activity.The protein forms a complex withThe RAD50 homolog;This complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase,This protein promotesThe joining of noncomplementary ends in vitro using short homologies nearThe ends ofThe DNA fragments.This gene has a pseudogene on chromosome 3. Alternative splicing ofThis gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Synonyms | ATLD; HNGS1; MRE11; MRE11B |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Homologous recombination, Non-homologous end-joining |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |