MPP2 Rabbit Polyclonal Antibody

CAT#: TA342243

Rabbit polyclonal Anti-Mpp2 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) (MPP2)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) (MPP2), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) (MPP2), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Mpp2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Mpp2. Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 60 kDa
Gene Name membrane palmitoylated protein 2
Background a protein related to CASK that may play a role in synaptic vesicle exocytosis and synaptic junctions [RGD, Feb 2006]. Sequence Note:The RefSeq transcript and protein were derived from genomic sequence to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: FQ211962.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
Synonyms DLG2
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...